[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55660.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->71 PF02575 * DUF149 5.2e-06 20.3 69/93  
:BLT:SWISS 3->78 Y2391_MICAN 5e-04 31.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55660.1 GT:GENE BAD55660.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 904874..905212 GB:FROM 904874 GB:TO 905212 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55660.1 LENGTH 112 SQ:AASEQ MSEQQGPVEWTASSRDGSITVRTTEQGLPRGIAIEPAELRRDPADLAAQVLRLCKQAANRAGVARREQLTAAGMAPEMLALLGLPTQEQVAGQELADEEEYEDQPRSWLREV GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 3->78|Y2391_MICAN|5e-04|31.6|76/114| HM:PFM:NREP 1 HM:PFM:REP 3->71|PF02575|5.2e-06|20.3|69/93|DUF149| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccEEEEEEccccEEEEEEccccccEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHcccccccccccc //