[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55661.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:99 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->87 PF02575 * DUF149 5.2e-09 15.9 69/93  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55661.1 GT:GENE BAD55661.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 905251..905550 GB:FROM 905251 GB:TO 905550 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55661.1 LENGTH 99 SQ:AASEQ MYETMDELEAAVRTRLYRLRDLAEDMSGVRASATSADGAITVEVDGNGTLLNLTFKQGISTMSPAEFEQALVSTSTAAAAAAFAQRADLVTAFNEEVAG GT:EXON 1|1-99:0| SEG 77->87|aaaaaafaqra| HM:PFM:NREP 1 HM:PFM:REP 19->87|PF02575|5.2e-09|15.9|69/93|DUF149| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //