[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55662.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->96 PF10824 * DUF2580 7.3e-11 31.2 93/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55662.1 GT:GENE BAD55662.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 905673..905993 GB:FROM 905673 GB:TO 905993 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55662.1 LENGTH 106 SQ:AASEQ MSDLVAAPDVIRGYADAAAAMAAGVATAGTVDQAATMAAVVPVFGLIGQDFLFAFAGAQANHLSSVMELAAVHAATAVTAQQSAAAYEATEATSVAGFDAAAHGLS GT:EXON 1|1-106:0| TM:NTM 3 TM:REGION 11->33| TM:REGION 36->58| TM:REGION 60->81| SEG 15->35|adaaaamaagvatagtvdqaa| SEG 70->96|aavhaatavtaqqsaaayeateatsva| HM:PFM:NREP 1 HM:PFM:REP 3->96|PF10824|7.3e-11|31.2|93/100|DUF2580| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 105-106| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccc //