[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55663.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:429 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55663.1 GT:GENE BAD55663.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 905990..907279 GB:FROM 905990 GB:TO 907279 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55663.1 LENGTH 429 SQ:AASEQ MTSPVDPTVLDLLRGSVLAPLIDRPVNDILRDMGLPPLPDPAAAPPLPELPPLPVIDIAALARPLTDMASSFGTGALDAAAGAGPNPAQMLSGIGTALQTAMTLGSTALQAAMAAWQGMGATAAAEKAGQAQQDGAELATQSTQEKAVLTGAATSVAVGAGLMSAVIAKYVASMVAAAPLLGSPGGQLFMVAATTEAIAEALAVIAKTRTELTAHSASMTQAGQKVPITSAPKGVDSMQQAMQMLQMLTPLMTMVGQSAQSLTQLAAANTALLAPKPAADPAAADAEQLDEAKALGGGAGGGAAGGGVGGGGGFAPAATPLSPYTGTRAAGVSPGVPGTGAELGATGSTARPGGTVPAGSPGGMVPMGGAAAGAAGARGAGDSGEVPGFLVNAQHGDEVVGDIEGVALPVVGATEQMPAEAPPDKDLTL GT:EXON 1|1-429:0| TM:NTM 1 TM:REGION 153->175| SEG 35->54|lpplpdpaaapplpelpplp| SEG 73->84|gtgaldaaagag| SEG 107->136|talqaamaawqgmgataaaekagqaqqdga| SEG 147->162|avltgaatsvavgagl| SEG 191->206|vaatteaiaealavia| SEG 238->254|mqqamqmlqmltplmtm| SEG 258->318|saqsltqlaaantallapkpaadpaaadaeqldeakalgggagggaagggvgggggfapaa| SEG 358->384|agspggmvpmggaaagaagargagdsg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 128-148, 150-152, 178-180, 204-401, 412-429| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHccccccHHHHHHHHHHHHHHHHHccccHHHcccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccc //