[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55664.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->98 PF00934 * PE 2.9e-09 20.5 88/94  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55664.1 GT:GENE BAD55664.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 907294..907635 GB:FROM 907294 GB:TO 907635 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55664.1 LENGTH 113 SQ:AASEQ MVRGGVDFAGVQFDPTVAREVATRLDDLADRLEQGLRDNEPALTVEPAGLDAVSTRAAQTMNQVAANYAENAAAGVLELRKLAAVLRGQVDEFGRAEDDNTADFGGAGSGGAA GT:EXON 1|1-113:0| SEG 65->74|aanyaenaaa| SEG 105->112|ggagsgga| HM:PFM:NREP 1 HM:PFM:REP 11->98|PF00934|2.9e-09|20.5|88/94|PE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 110-113| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //