[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55665.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.4
:327 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  14->181 2g38B1  a.25.4.2 * 3e-14 15.7 %
:HMM:SCOP  13->187 2g38B1 a.25.4.2 * 2.6e-27 33.5 %
:HMM:PFM   16->173 PF00823 * PPE 4.6e-32 34.0 156/159  
:BLT:SWISS 16->86 PPE22_MYCTU 3e-06 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55665.1 GT:GENE BAD55665.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 907667..908650 GB:FROM 907667 GB:TO 908650 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55665.1 LENGTH 327 SQ:AASEQ MIEPPQPGFTGVVWEAMEPDRMARELRTGPGSVPLAEAGAAWGRLAESFGAAVVEYELVMATLRGAWQSTTSRDVLEKVTGLRDWLIEAAGAAADHAAKAHAQAAAYEVARLAMPDGGELAALAEAKRMLEAMTAGLGAPIRAVAAETDADADVAKAAASRVMRAYEAATEPLAMPWEQREPPALVSPAALAAEQTAAAAPPVTAGAVPPAAPGVVRAGGYGLGAIPRAKTAYQAPVFVQSAETETLTHTAPAPQPVPAGGSAVPLVPGAVGAAAAAQEQEYESPSGATAVGDALGAELGIVAAPAVLGAPEPGAVPQDRGTTGSAP GT:EXON 1|1-327:0| BL:SWS:NREP 1 BL:SWS:REP 16->86|PPE22_MYCTU|3e-06|33.8|71/385| SEG 89->110|aagaaadhaakahaqaaayeva| SEG 143->159|avaaetdadadvakaaa| SEG 182->220|ppalvspaalaaeqtaaaappvtagavppaapgvvragg| SEG 256->277|pvpaggsavplvpgavgaaaaa| HM:PFM:NREP 1 HM:PFM:REP 16->173|PF00823|4.6e-32|34.0|156/159|PPE| RP:SCP:NREP 1 RP:SCP:REP 14->181|2g38B1|3e-14|15.7|166/173|a.25.4.2| HM:SCP:REP 13->187|2g38B1|2.6e-27|33.5|173/0|a.25.4.2|1/1|PE/PPE dimer-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 189-197, 252-261, 279-288, 318-327| PSIPRED ccccccccccEEEcccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccEEEcccccHHHccccccccccccccHHHHHHHHHHHHHHcccEEEccccccccccccccccHHHHHHHHHccccccccccccccccccc //