[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55666.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:264 amino acids
:PSIPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55666.1 GT:GENE BAD55666.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 908647..909441 GB:FROM 908647 GB:TO 909441 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55666.1 LENGTH 264 SQ:AASEQ MTTLTNDGVLALAERLGIQTMPLVLGIGPRQQTYDAWTAAQRRAVADLTGAGLIDGYGEVDPELADAMYVLAQPDRELVARVYPGDGAPTRLCLALRGERHALALRRGDDIRIEPAWSDESGSALVAALLRALGPAEPADVAPFSAPAAELAERLSAARTSADFTDAVYALGVAERDAPRYGLAFESCRAYAEIVAYAHVDGVTTRPPCAAVVYETGRGRIVVAPGIAPDQQVWSTVTPGTDHRVAQAISGLIETLPGGRWLPQ GT:EXON 1|1-264:0| SEG 145->159|sapaaelaerlsaar| OP:NHOMO 44 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------21122-23112221222123232111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEHHHHHHHHHHHccccccHHcccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccEEEEEEEEcccccccEEEEEEcccEEEEEEEccEEEEEEcccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHccccEEEEEEEEccccccccccccEEEEEEccccEEEEEccccccccEEEEEccccHHHHHHHHHHHHHHccccccccc //