[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55667.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->93 1wa8B1 a.25.3.1 * 2.9e-12 26.9 %
:HMM:PFM   2->85 PF06013 * WXG100 2.7e-13 21.4 84/86  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55667.1 GT:GENE BAD55667.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 909521..909817 GB:FROM 909521 GB:TO 909817 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55667.1 LENGTH 98 SQ:AASEQ MVQAQHDIAEAAKNEMADAVDAIQRTLAAIDTAVDAARAGWKGEANTAFAQAVAEWDAETHRLNGVLREIEQQVGTGTVQLREMDAQGYEEFGGLRLA GT:EXON 1|1-98:0| SEG 28->39|aaidtavdaara| HM:PFM:NREP 1 HM:PFM:REP 2->85|PF06013|2.7e-13|21.4|84/86|WXG100| HM:SCP:REP 1->93|1wa8B1|2.9e-12|26.9|93/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHccccccc //