[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55668.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:98 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  3->97 1wa8B1 a.25.3.1 * 6e-13 25.3 %
:HMM:PFM   8->90 PF06013 * WXG100 3.9e-08 23.2 82/86  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55668.1 GT:GENE BAD55668.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 909858..910154 GB:FROM 909858 GB:TO 910154 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55668.1 LENGTH 98 SQ:AASEQ MSDHMLYDEATMTELFNNLNENYAKLQQEGENLETAAAKLSQAWEGNAALAGFTTVKSKWDNEFGDTLVILNKVAAAVENALQRALGTDQKIGDGFSF GT:EXON 1|1-98:0| HM:PFM:NREP 1 HM:PFM:REP 8->90|PF06013|3.9e-08|23.2|82/86|WXG100| HM:SCP:REP 3->97|1wa8B1|6e-13|25.3|91/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccc //