[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55675.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->102 PF09159 * Ydc2-catalyt 0.00066 41.7 24/259  
:HMM:PFM   119->156 PF09228 * Prok-TraM 0.001 28.6 35/102  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55675.1 GT:GENE BAD55675.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 922916..923446 GB:FROM 922916 GB:TO 923446 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55675.1 LENGTH 176 SQ:AASEQ MAGSDSSTVVMAISPATACAGPAVGADAPGVLPSSDLLVRACRGHRVVGGPLLWFARDLAVLHERRLVGRGGSIESDPAVILENQRRRGELVMAIDDWVLRSVPQHRLGATLHTETVGAVIDRLAESAVRAHHALVTLDAHDEMLHGAWHHLAELADAYDALVREVVAGRRRLPEW GT:EXON 1|1-176:0| SEG 15->30|patacagpavgadapg| HM:PFM:NREP 2 HM:PFM:REP 79->102|PF09159|0.00066|41.7|24/259|Ydc2-catalyt| HM:PFM:REP 119->156|PF09228|0.001|28.6|35/102|Prok-TraM| OP:NHOMO 3 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 174-176| PSIPRED cccccccEEEEEEccHHHHcccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //