[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55676.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:446 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   225->437 2afkG PDBj 7e-07 12.9 %
:RPS:SCOP  198->437 1cp2A  c.37.1.10 * 4e-11 12.3 %
:HMM:SCOP  197->444 1ionA_ c.37.1.10 * 2.6e-32 26.7 %
:HMM:PFM   199->409 PF01656 * CbiA 2.5e-14 26.9 171/194  
:BLT:SWISS 222->329 ZNF18_RAT 7e-04 29.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55676.1 GT:GENE BAD55676.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(923475..924815) GB:FROM 923475 GB:TO 924815 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55676.1 LENGTH 446 SQ:AASEQ MSDQPAPGVLGRDPNVFAQAPADPSMPGWNQPPPSAPPDSPYGAPAAQQGYPAAPPFAAAPGNYHIPGDRRPGEPGYLPEPGYPAAPGEQHPPRSGQPPVQAQVAPVPQAPPPSSTPPWNPAGGASQWGQVPPQAPQPGHPSLDDVPMRRAKRAPGSGWRKAVHHMSGGAINPGMSAEERRLQELVARIRQPVRGDYRIAVLSLKGGVGKTTTTMGLGSIFASIRGDRVIAVDANPDFGTLSQRVPLQTRSTVRDLLLDPSIERYSDVRRHTSQATSRLEVLASERDPAASEAFNDEEYRAVARILQRFYNIILTDCGTGLMHSAMAGVLDLAHSLVLVSSAAIDGARSAAATLDWLSLHGHDHLVRNAVVVINLPREGSPNVGVQQLREYFLSRCRAVHIIPYDQHLSEGAEIDLHRLSKQAKRAYVELAATVADQFGVDHRRYH GT:EXON 1|1-446:0| BL:SWS:NREP 1 BL:SWS:REP 222->329|ZNF18_RAT|7e-04|29.2|106/100| SEG 32->61|pppsappdspygapaaqqgypaappfaaap| SEG 72->89|pgepgylpepgypaapge| SEG 97->113|qppvqaqvapvpqappp| SEG 204->218|lkggvgkttttmglg| SEG 340->352|ssaaidgarsaaa| RP:PDB:NREP 1 RP:PDB:REP 225->437|2afkG|7e-07|12.9|210/272| HM:PFM:NREP 1 HM:PFM:REP 199->409|PF01656|2.5e-14|26.9|171/194|CbiA| RP:SCP:NREP 1 RP:SCP:REP 198->437|1cp2A|4e-11|12.3|236/269|c.37.1.10| HM:SCP:REP 197->444|1ionA_|2.6e-32|26.7|236/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 120 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- --------------44444-44223355555-34353332-1111-1--2-1124--1--221-1121113---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 47.8 SQ:SECSTR ################################################################################################################################################################################################################################HTccEEEEEEcccccccHHHHcccccccHHHHHHHHccTTTcccTTTcEEcGGGcEEEEcccccTTcccHHHHHHHHHHHHHHHcEEEEEEccccccGGGGGGGcTTcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccTTHHHHHHHHHHHHTcTccEEEEEcccTHHHHHHHHHHcTTcHHHHHHHHHHHHHHHTc######### DISOP:02AL 1-6, 8-192, 439-446| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHccccccccHHHHHHccccccHHHHHHHHHccccccEEEEccccHHHHHHccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHccEEEEccccccccccccEEEEccccHHHHHHHHHHHHHHHHccccHHccc //