[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55685.1
DDBJ      :             putative heat shock protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  88/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->127 2byuA PDBj 2e-05 40.0 %
:RPS:PDB   36->131 2byuA PDBj 1e-15 26.0 %
:RPS:SCOP  37->139 1gmeB  b.15.1.1 * 3e-20 30.1 %
:HMM:SCOP  9->137 1gmeA_ b.15.1.1 * 3.9e-35 38.8 %
:RPS:PFM   39->137 PF00011 * HSP20 2e-14 39.4 %
:HMM:PFM   43->137 PF00011 * HSP20 3.9e-25 31.9 94/102  
:BLT:SWISS 4->137 18K2_MYCAV 4e-26 45.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55685.1 GT:GENE BAD55685.1 GT:PRODUCT putative heat shock protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(932870..933328) GB:FROM 932870 GB:TO 933328 GB:DIRECTION - GB:PRODUCT putative heat shock protein GB:PROTEIN_ID BAD55685.1 LENGTH 152 SQ:AASEQ MEVIAVLRFDPFHDIDTVARHLLGEGTGTARAPRFMPMDLFKAGDHYVLNADLPGVDPGSVDVSVDNGTLTLRAQRSVPSEEGVQWIASERFAGTYMRQLSLGDNVDTDKISATYNNGVLSVTIPIAEKAKPRRIEITGGSEQKTIEASSNN GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 4->137|18K2_MYCAV|4e-26|45.3|128/138| SEG 54->66|pgvdpgsvdvsvd| BL:PDB:NREP 1 BL:PDB:REP 38->127|2byuA|2e-05|40.0|90/101| RP:PDB:NREP 1 RP:PDB:REP 36->131|2byuA|1e-15|26.0|96/101| RP:PFM:NREP 1 RP:PFM:REP 39->137|PF00011|2e-14|39.4|99/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 43->137|PF00011|3.9e-25|31.9|94/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 37->139|1gmeB|3e-20|30.1|103/109|b.15.1.1| HM:SCP:REP 9->137|1gmeA_|3.9e-35|38.8|129/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 115 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ---11---------143----11111-----111111133211-2----11211111-----111-12--------------1-------------------------2------------------------------22------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1---------------------------------------------------------1---------1--------------------------------------------------------------------1111---211111---1-2----32-------1--------------------11-1---2-2------------1--1-111-11-1--2------------------------------------------------------------1-11---------------------------------------------------------------------------------------------11111----2-1--------------------------------------1-----------------------------------------------3-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 78.9 SQ:SECSTR #############################cccEEEccEEEEEcccEEEEEEEcTTccGGGEEEEEETTTEEEEEcccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEEccccccccccccccccTTEEEcTT### DISOP:02AL 24-29, 77-84, 128-152| PSIPRED ccccccccccHHHHHHHHHHHHccccccccccccccEEEEEEcccEEEEEEEEcccccccEEEEEEccEEEEEEEEcccccccccEEEEEEcccEEEEEEEccccccccEEEEEEEccEEEEEEEcccccccEEEEEccccccccccccccc //