[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55686.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   69->271 3c8nB PDBj 4e-11 16.5 %
:RPS:SCOP  30->266 1brlB  c.1.16.1 * 2e-11 17.8 %
:HMM:SCOP  9->284 1rhcA_ c.1.16.3 * 2.6e-40 30.0 %
:HMM:PFM   30->261 PF00296 * Bac_luciferase 2.1e-20 28.9 228/307  
:BLT:SWISS 69->160 DNLJ_AZOSE 8e-04 38.9 %
:BLT:SWISS 139->262 MER_ARCFU 4e-05 30.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55686.1 GT:GENE BAD55686.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 933450..934301 GB:FROM 933450 GB:TO 934301 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55686.1 LENGTH 283 SQ:AASEQ MGVGGVARGMTAHELGRFGVWRGYKGFRPEEAAELERLGYGALWLGGSPPAALPTVEPLLAATTTLTVGTSIVNIWTAPAAEVAESFHRIDARYPGRFLLGIGVGHPEAVSAYRKPYDALVEYLDDLDAAGVPRERRAVAALGPRVLELARDRAAGALPYLTTPEHTRRARDVLGAASLLAVEQKLVVDDDAERARALGRPVVARYLGLRNYVANLRRLGYSESDVAGQGSDRLVDALAVHGTPAQVADRLRAHRDAGADHVALQPLEDDYLAPLRALAPLLR GT:EXON 1|1-283:0| BL:SWS:NREP 2 BL:SWS:REP 69->160|DNLJ_AZOSE|8e-04|38.9|90/100| BL:SWS:REP 139->262|MER_ARCFU|4e-05|30.9|123/332| SEG 49->68|ppaalptvepllaatttltv| SEG 272->282|laplralapll| RP:PDB:NREP 1 RP:PDB:REP 69->271|3c8nB|4e-11|16.5|200/323| HM:PFM:NREP 1 HM:PFM:REP 30->261|PF00296|2.1e-20|28.9|228/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 30->266|1brlB|2e-11|17.8|225/319|c.1.16.1| HM:SCP:REP 9->284|1rhcA_|2.6e-40|30.0|273/0|c.1.16.3|1/1|Bacterial luciferase-like| OP:NHOMO 78 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- --------------33311-13--3611111243331131-8281---------------11---11-12------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 85.5 SQ:SECSTR #############################HHHHHHHTTTccEEEEccccccHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHcTTcEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHTTTTcccEEEEcccHHHHHHHHHHccEEEEEcccHHHHHHTHHHHHHHGcEEEEEEEEEcccHHHHHTTGGGGGGGccHHHHHHcccHHHHHHHHTccTccHHHHHTTcEEEccHHHHHHHHHHHHHTTccEEEEEcccccH############ DISOP:02AL 1-3| PSIPRED ccccccccccccccccccccccccccccHHHHHHHHHccccEEEEccccccHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHHccHHHHHHccHHHHHHHHHHccccccccccEEEEEEccHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHccccHHHHccEEEEccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHcc //