[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55687.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  259/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->100 2hh7A PDBj 1e-10 33.8 %
:RPS:PFM   18->103 PF02583 * DUF156 2e-17 50.0 %
:HMM:PFM   20->102 PF02583 * DUF156 1.5e-32 46.3 82/85  
:BLT:SWISS 10->106 CSOR_BACSU 3e-20 46.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55687.1 GT:GENE BAD55687.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(934309..934629) GB:FROM 934309 GB:TO 934629 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55687.1 LENGTH 106 SQ:AASEQ MTTPDASSTHDHAAHGYITSKDDYLKRLRRIEGQARGLQRMVEEEKYCIDILTQVSAMTKALQAVAMGLLEDHISHCVVDAAVAGGPEAEAKIKEATDAIARLVRS GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 10->106|CSOR_BACSU|3e-20|46.3|95/101| BL:PDB:NREP 1 BL:PDB:REP 25->100|2hh7A|1e-10|33.8|74/85| RP:PFM:NREP 1 RP:PFM:REP 18->103|PF02583|2e-17|50.0|84/84|DUF156| HM:PFM:NREP 1 HM:PFM:REP 20->102|PF02583|1.5e-32|46.3|82/85|DUF156| OP:NHOMO 311 OP:NHOMOORG 260 OP:PATTERN ---------------------------------1---------------------------------- ----11-111111111211-1411311111112243122211112111211-211111--113111111111---11111111-1-----------------------1---------------------------111-----11-11-11111---------1111111-------------11--11-221111111211112121111111111212121111111131-111-1111111111111111------------------------------------------------------------11---1111-12--11111111-1-1---1112----2111-5411-11211211----1--1--1-------11421111111----------1-111-311-----------------11-21---------------------1----------------------------------1-------------------------------------------------1----------11---------1---11--------1----1-1---11121-1--1-1-----------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1--1-1-1-11111111-------------------------------------11-------------------------------------111--------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 69.8 SQ:SECSTR ########################HHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTcccTT##HHHHHHHHHHHTT###### DISOP:02AL 1-20, 81-93| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc //