[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55698.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->96 1wa8B PDBj 6e-07 25.0 %
:HMM:SCOP  3->97 1wa8B1 a.25.3.1 * 6.9e-16 29.7 %
:HMM:PFM   4->90 PF06013 * WXG100 9.8e-17 22.1 86/86  
:BLT:SWISS 20->96 ESXA_MYCLE 1e-06 23.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55698.1 GT:GENE BAD55698.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(949977..950267) GB:FROM 949977 GB:TO 950267 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55698.1 LENGTH 96 SQ:AASEQ MSQQISANFAGVEDGARQIIKRAEGIRDELEAFHKKVEEFVTTNWKGATNEAFAQLQRTWQQNVDQLNTTLAGAGQLVSSGNSELQSTDSALANLF GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 20->96|ESXA_MYCLE|1e-06|23.4|77/95| BL:PDB:NREP 1 BL:PDB:REP 8->96|1wa8B|6e-07|25.0|88/95| HM:PFM:NREP 1 HM:PFM:REP 4->90|PF06013|9.8e-17|22.1|86/86|WXG100| HM:SCP:REP 3->97|1wa8B1|6.9e-16|29.7|91/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 91.7 SQ:SECSTR #######cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGG#GcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTTTTcTTccTTTc DISOP:02AL 1-8, 80-85| PSIPRED cccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcc //