[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55699.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  5->99 1wa8A1 a.25.3.1 * 6e-14 30.1 %
:HMM:PFM   8->93 PF06013 * WXG100 4.6e-19 32.1 84/86  
:BLT:SWISS 45->96 YFJA_BACSU 7e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55699.1 GT:GENE BAD55699.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(950303..950638) GB:FROM 950303 GB:TO 950638 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55699.1 LENGTH 111 SQ:AASEQ MAEAGSLDASPELIAQKAKEFQEQHANLMAAIRTLKADEDAVTNGANWKGQARDAFNAFMERYYFQADKLNDKLMETSEKLIKAGSSFADQDTDFASKVQAQVSSLDLPPV GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 45->96|YFJA_BACSU|7e-04|30.8|52/100| HM:PFM:NREP 1 HM:PFM:REP 8->93|PF06013|4.6e-19|32.1|84/86|WXG100| HM:SCP:REP 5->99|1wa8A1|6e-14|30.1|93/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccc //