[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55705.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:403 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55705.1 GT:GENE BAD55705.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(957553..958764) GB:FROM 957553 GB:TO 958764 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55705.1 LENGTH 403 SQ:AASEQ MPGRHWVRRVAGFVVVVAAVAGCGQTVPGLPQAGMAPVELTALNLGPYPGEPVDYESEVSTKMDVFRIEARRMLGFLVSPDEVDPEMDHLDELRVVESLDSLFGEPPLGIYPAAFKPVMDRNFLLAGVTTTRSNNTPRTIRNTLHSLLRFPSDAAARTAAAELATTMAELVPGGRRVPVPGHSGLEFLTADDKKGFLFAARGPFTLLSMVTLPAPDPAGLGDRISKLVTLQFDRIDKTPVVPVDEILDLPADPDGIMRRTLPPGDGEYSDLPRQFVGALSPAARLHFERDAAALRPVFERAGVDLVGQYSGVVYRTADLQSAFLLQTALARLGRYDEEIDPPPGLTDARCWKIDDRDPVRSSTYKCALVRGRYVAVVESARMTFDAGLYQRAAAQYSILAKSE GT:EXON 1|1-403:0| TM:NTM 1 TM:REGION 10->32| SEG 7->22|vrrvagfvvvvaavag| SEG 154->168|aaartaaaelattma| OP:NHOMO 4 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------1-3-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 402-403| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccccccccccHHHHHHHHHHHHHHcccHHHccccEEEcccEEEEEccccccccccHHHHHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEHEEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHccccHHHHHEEEccccccccccccccccccccccEEEEEcccHHHHHHHHHHcccEEEEEEcEEEEEEccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEccEEEEEEcccccccHHHHHHHHHHHHHHHccc //