[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55710.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4
:480 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  48->146 1bbuA1  b.40.4.1 * 8e-08 18.8 %
:BLT:SWISS 36->145 SYD_PHEZH 2e-04 30.2 %
:BLT:SWISS 131->230 SYP_ANADF 8e-04 32.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55710.1 GT:GENE BAD55710.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 965728..967170 GB:FROM 965728 GB:TO 967170 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55710.1 LENGTH 480 SQ:AASEQ MPVTVRVGAVHLGWDVVSVAAGGGGTPIRPVKVEGTYTPPAYLLADAAGRLHTAGAERQRRDLGMAIADVRDILGYPQIVVAGATWPAELVFHARMYHPLAAIGGYLRGKPDVVALPFPDGWPDEKVELYAELVEKLDIAVEPLPESVALSGYVRAIGLVRPPDERDPRGVGATGVYSDGRTMLVVAVHGDDEQPTESIEVPVTADAMRDAHSADNVVIEAMAAARSIGADTATVLLTGNVCFNEALRLAFQNHLGHRLQVAQHPMHALVLGATHLLVTEAAEAGPPAAPPYPPQQAPRPATAPGSPVVTYGPGYPTGAPAGEEPTTRVTRPDPSGGVPPHAAGPGSRFTRPPGHGDDQTTVLARPHAAQGTGAAGTVWSKMKDNFLGAPAVIGAVALAVVALPGDAGAPPASGTEAAAVDRVVRTCGTTPRVEQQRQGIATVRDGTTTEPDCTQPNMDTLRYVVPGPPGAVDPGPPVEI GT:EXON 1|1-480:0| BL:SWS:NREP 2 BL:SWS:REP 36->145|SYD_PHEZH|2e-04|30.2|106/592| BL:SWS:REP 131->230|SYP_ANADF|8e-04|32.0|97/100| SEG 279->305|teaaeagppaappyppqqaprpatapg| SEG 310->325|tygpgyptgapageep| SEG 387->412|lgapavigavalavvalpgdagappa| SEG 464->478|vvpgppgavdpgppv| RP:SCP:NREP 1 RP:SCP:REP 48->146|1bbuA1|8e-08|18.8|85/144|b.40.4.1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 290-303, 319-336, 477-480| PSIPRED ccEEEEEEEEEEccEEEEEEccccccccEEEEEccccccHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccEEcccccHHHHHHHHHHHcccccccccccccccccEEEccccEEEEEEEEcccccccccEEccEEHHHHHHHccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHEEEHHHHccccccccccHHHccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEEcccccccccHHEEEcccccccccccHHHHHHHHHcccccHHHHHHHHHHHEEcccccccccccccHHHHHHHHHHHHcccccHHHHHcccEEEcccccccccccccccccEEEEEccccccccccccccc //