[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55716.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->60 PF04024 * PspC 1e-07 54.2 %
:HMM:PFM   6->61 PF04024 * PspC 1.4e-25 46.4 56/61  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55716.1 GT:GENE BAD55716.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 972417..972605 GB:FROM 972417 GB:TO 972605 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55716.1 LENGTH 62 SQ:AASEQ MTAPTRRLTRSDDKWIAGVCGGIAEYFGWSAGVVRLLFVLSCLLPGPQFLLYAILWVVIPKR GT:EXON 1|1-62:0| TM:NTM 1 TM:REGION 35->57| RP:PFM:NREP 1 RP:PFM:REP 13->60|PF04024|1e-07|54.2|48/62|PspC| HM:PFM:NREP 1 HM:PFM:REP 6->61|PF04024|1.4e-25|46.4|56/61|PspC| OP:NHOMO 38 OP:NHOMOORG 36 OP:PATTERN ----------------------------------------------1--------------------- -----11-11----1---------------------11------1----1--1-1--2------11111----------------------1-1------------------------------------------1112----1--------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-1-------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccc //