[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55717.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->46 PF01839 * FG-GAP 0.00055 58.3 12/33  
:BLT:SWISS 9->86 MNME_PSYIN 1e-04 39.7 %
:REPEAT 2|35->56|58->80

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55717.1 GT:GENE BAD55717.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 972688..972996 GB:FROM 972688 GB:TO 972996 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55717.1 LENGTH 102 SQ:AASEQ MVTSGEFGGLELPGIDTSSSLGGLGPVELEHPTQDIDGDGLLDTATTRGEDAMQVWTDFDHDGIADHVTVVENDGDYSAWEFHRHPDGTSEWVRTDQGKLGE GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 9->86|MNME_PSYIN|1e-04|39.7|78/455| NREPEAT 1 REPEAT 2|35->56|58->80| HM:PFM:NREP 1 HM:PFM:REP 35->46|PF01839|0.00055|58.3|12/33|FG-GAP| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 99-102| PSIPRED cccccccccEEcccccccccccccccEEEccccccccccccEEcccccccccEEEEccccccccccEEEEEEccccccEEEEEcccccccHHEEcccccccc //