[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55718.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   13->113 PF10824 * DUF2580 4.4e-07 24.0 96/100  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55718.1 GT:GENE BAD55718.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 973117..973482 GB:FROM 973117 GB:TO 973482 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55718.1 LENGTH 121 SQ:AASEQ MPDPTGRGGTVSSQNLGVQTGELGKFANDLRLSAGVVGTSAQRVSQHMFGDGSNGHGPEAGRNYVSQGAAIHTGLENVVKWLENWGAAGKAVADSIGAATVVYSDTDAEAAKKTRQQTQNV GT:EXON 1|1-121:0| HM:PFM:NREP 1 HM:PFM:REP 13->113|PF10824|4.4e-07|24.0|96/100|DUF2580| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 69.4 SQ:SECSTR ###TccccHHHHHHHccccHHHHHHHHHHHHHTTcccccccccccccGGGccccHHHHHHHTTHHHHTHHHHTHHHHHHHHHHHHTc################################## DISOP:02AL 1-8, 51-56, 111-121| PSIPRED ccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHcccEEEEEccccHHHHHHHHHHHccc //