[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55719.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.3c.1.8
:602 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  492->545 1b1yA  c.1.8.1 * 5e-04 13.0 %
:HMM:SCOP  56->153 1wa8B1 a.25.3.1 * 0.00015 22.3 %
:RPS:PFM   486->555 PF07415 * Herpes_LMP2 4e-05 33.3 %
:HMM:PFM   60->111 PF06013 * WXG100 0.00032 26.9 52/86  
:BLT:SWISS 450->563 RGS3_HUMAN 4e-07 34.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55719.1 GT:GENE BAD55719.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 973512..975320 GB:FROM 973512 GB:TO 975320 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55719.1 LENGTH 602 SQ:AASEQ MASTTLPDLSGDNVDRMLDDGATGLQYFAQLHGRYTEAFGHEPSHSLDRIYALYDEQRGMDLDKLAATAGALATTLGEVDEQWDTQKALSERLPTVWQGQAAEAAQYMFGQQVTMADDDRAKARAALDAMTTAIPALRTAVRAKADHVKKLVNGQVEVGSLTVDDLDMLIACAAGGVGRALTHDLPDLLSKAAGNVLNYYVGGLGLSYLGGRVVASRILERVFKPHFDARLQNYVDMCKLTDDAVKSAYAALVTAVDELDRNPYPQPAVQNSTPSTPGDNTTNPGTNTTNPGSNTTNPGSNTTNPGTNTTNPGSNTTNPGTNTVVPGNDTSTPSTPGSDDPGQTNPAGTANPLSGLAGLSQLAQQLSPLATTLAQEIQTGLTSLSGQVSDGIDKAVEQWQSALQHDTAAEDDAPGTDADDPDGDAKEKGVSAEFDLGDKHLEFTVGPDGQPKLVATGPDGSVQEYTLELDENGRPVIVESGTGKDDSDGEQPPASDRPSGDESNPQQPAGRQPAEAMSPGEQPDAGQPSAAQPTPPADDPSAEEGSPAGSTQPAPGVSGLPAGARREEDGEHQAQPLPVDAPAADTDQPADSGAQLAEAGPL GT:EXON 1|1-602:0| BL:SWS:NREP 1 BL:SWS:REP 450->563|RGS3_HUMAN|4e-07|34.9|109/1198| SEG 65->77|laatagalattlg| SEG 114->133|tmadddrakaraaldamtta| SEG 194->214|gnvlnyyvgglglsylggrvv| SEG 271->323|nstpstpgdnttnpgtnttnpgsnttnpgsnttnpgtnttnpgsnttnpgtnt| SEG 352->375|plsglaglsqlaqqlsplattlaq| SEG 406->428|dtaaeddapgtdaddpdgdakek| SEG 578->591|pvdapaadtdqpad| RP:PFM:NREP 1 RP:PFM:REP 486->555|PF07415|4e-05|33.3|69/448|Herpes_LMP2| HM:PFM:NREP 1 HM:PFM:REP 60->111|PF06013|0.00032|26.9|52/86|WXG100| RP:SCP:NREP 1 RP:SCP:REP 492->545|1b1yA|5e-04|13.0|54/500|c.1.8.1| HM:SCP:REP 56->153|1wa8B1|0.00015|22.3|94/0|a.25.3.1|1/1|EsxAB dimer-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 232-602| PSIPRED cccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //