[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55722.1
DDBJ      :             putative copper-binding protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  30/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.6.1
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->139 2qdvA PDBj 6e-12 42.5 %
:RPS:PDB   58->132 1bqkA PDBj 1e-09 26.7 %
:RPS:SCOP  58->139 1aacA  b.6.1.1 * 7e-12 37.8 %
:HMM:SCOP  38->139 1sfdA_ b.6.1.1 * 9.3e-23 33.3 %
:RPS:PFM   58->138 PF00127 * Copper-bind 2e-04 42.0 %
:HMM:PFM   57->139 PF00127 * Copper-bind 1.6e-11 31.3 83/99  
:HMM:PFM   5->59 PF10738 * Lpp-LpqN 0.00017 27.3 55/241  
:BLT:SWISS 58->139 AMCY_PARDE 7e-11 41.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55722.1 GT:GENE BAD55722.1 GT:PRODUCT putative copper-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(978697..979116) GB:FROM 978697 GB:TO 979116 GB:DIRECTION - GB:PRODUCT putative copper-binding protein GB:PROTEIN_ID BAD55722.1 LENGTH 139 SQ:AASEQ MPTLHRGLSARVVAALALTASIALAGCGSDASESAPSSTSALTTSAPATSAPAGPSSVTVTVDDMTFSPENITVGVGDTVTWKFSDSAPHSVQGIGDKAMGINSPILDSGEWSYTFTVPGTFRYLCTLHPQMRGSVTVE GT:EXON 1|1-139:0| BL:SWS:NREP 1 BL:SWS:REP 58->139|AMCY_PARDE|7e-11|41.2|80/131| SEG 14->25|aalaltasiala| SEG 29->57|sdasesapsstsalttsapatsapagpss| BL:PDB:NREP 1 BL:PDB:REP 58->139|2qdvA|6e-12|42.5|80/105| RP:PDB:NREP 1 RP:PDB:REP 58->132|1bqkA|1e-09|26.7|75/124| RP:PFM:NREP 1 RP:PFM:REP 58->138|PF00127|2e-04|42.0|81/100|Copper-bind| HM:PFM:NREP 2 HM:PFM:REP 57->139|PF00127|1.6e-11|31.3|83/99|Copper-bind| HM:PFM:REP 5->59|PF10738|0.00017|27.3|55/241|Lpp-LpqN| GO:PFM:NREP 2 GO:PFM GO:0005507|"GO:copper ion binding"|PF00127|IPR000923| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00127|IPR000923| RP:SCP:NREP 1 RP:SCP:REP 58->139|1aacA|7e-12|37.8|82/105|b.6.1.1| HM:SCP:REP 38->139|1sfdA_|9.3e-23|33.3|102/0|b.6.1.1|1/1|Cupredoxins| OP:NHOMO 53 OP:NHOMOORG 37 OP:PATTERN ---------------------------------------11--1------3-3--------------7 -1--1---------111-------------------1311-----------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------1-------------------1-----1---------------------------------------------------------------211112-----111-------1-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 59.0 SQ:SECSTR #########################################################EEETTEEEEEEccEEEEcTTcEEEEEccccccccEEcTTccTTcccccccTTccEEEEccccEEEEEEcTTTGGGEEEEEEc DISOP:02AL 1-7, 101-109| PSIPRED ccccHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccccccccccccccccEEEEEEccEEEcccEEEEccccEEEEEEcccccEEEEEEcccccccccccccccEEEEEEcccEEEEEEEEEccccEEEEEEc //