[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55726.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  261/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.258.1c.37.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->97 1htwA PDBj 5e-09 46.3 %
:RPS:PDB   27->78 3czpB PDBj 5e-04 19.2 %
:RPS:SCOP  3->73 2aplA1  a.258.1.1 * 6e-08 12.7 %
:HMM:SCOP  1->141 1htwA_ c.37.1.18 * 2.9e-13 26.5 %
:RPS:PFM   22->97 PF02367 * UPF0079 3e-17 52.9 %
:HMM:PFM   22->147 PF02367 * UPF0079 6.7e-35 40.8 120/123  
:BLT:SWISS 17->155 Y3456_MYCBO 3e-23 55.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55726.1 GT:GENE BAD55726.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 983334..983831 GB:FROM 983334 GB:TO 983831 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55726.1 LENGTH 165 SQ:AASEQ MNEDERTVVAKHQRTLPTVADTEALGRELAAQLAAGDLVVLDGPLGAGKTALTRGIAAGLGVQGRVSSPTFIIARQHRAGPRDGAPPVPMVHVDAYRLGGDLDELDALDLDTDLHQAVVVVEWGRGVVEHLTDRHLWVRLTREPDSEVRTAVWEWVDRQPSPPSR GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 17->155|Y3456_MYCBO|3e-23|55.9|136/168| SEG 98->114|lggdldeldaldldtdl| SEG 118->129|vvvvewgrgvve| BL:PDB:NREP 1 BL:PDB:REP 38->97|1htwA|5e-09|46.3|54/158| RP:PDB:NREP 1 RP:PDB:REP 27->78|3czpB|5e-04|19.2|52/452| RP:PFM:NREP 1 RP:PFM:REP 22->97|PF02367|3e-17|52.9|70/123|UPF0079| HM:PFM:NREP 1 HM:PFM:REP 22->147|PF02367|6.7e-35|40.8|120/123|UPF0079| RP:SCP:NREP 1 RP:SCP:REP 3->73|2aplA1|6e-08|12.7|71/149|a.258.1.1| HM:SCP:REP 1->141|1htwA_|2.9e-13|26.5|132/158|c.37.1.18|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 263 OP:NHOMOORG 261 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-1111111111111111111111111-1-11111-111111-111-11---1111111-1-1---------------------------1---------------------------1111111111111-11---111111-1-1-1-11-11--11111--11--11---11111111121111111111111111111111111111111---------------------1-1----1-----11---11-1--1111111111111111111111111111111111111111111111-1-11-------1-11-11-11111---111-111111111-111-----1--1------------------------------------------------------------1---------------------------------------------------------1---1------------------------------------------------1--------1---------1-------1-------------1----1-----------------------------------11--1-------------------------------------------------------------------------------------------------------------111111111111-----1111----------------------------------1--------1--------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 43.0 SQ:SECSTR ##########################HHHHHHccccEEEEEEEcTTccHHHHHHHHHHHcGGGEEEEcccccHHHHTcccccccccHHHHHHHHHHH#################################################################### DISOP:02AL 1-8, 158-165| PSIPRED ccHHHHHHHHEEEEEEccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHccccccccccEEEEEEEEEccccccccccEEEEEEEEEccccHHHHHHcccHHHccccEEEEEcHHHHHHHcccccEEEEEEEEccccEEEEEEEEcccccccccc //