[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55727.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  279/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:233 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->215 2gelA PDBj 4e-13 33.7 %
:RPS:PDB   3->217 2a6aA PDBj 8e-19 30.1 %
:RPS:SCOP  3->108 1okjA1  c.55.1.9 * 2e-15 35.5 %
:RPS:SCOP  124->214 1okjA2  c.55.1.9 * 2e-08 27.5 %
:HMM:SCOP  1->117 2a6aA1 c.55.1.9 * 3.7e-21 43.7 %
:HMM:SCOP  124->214 1okjA2 c.55.1.9 * 1.3e-18 35.2 %
:RPS:PFM   45->104 PF00814 * Peptidase_M22 4e-10 53.3 %
:HMM:PFM   45->161 PF00814 * Peptidase_M22 8.4e-27 38.9 113/268  
:BLT:SWISS 35->220 Y378_MYCLE 3e-50 60.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55727.1 GT:GENE BAD55727.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 983875..984576 GB:FROM 983875 GB:TO 984576 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55727.1 LENGTH 233 SQ:AASEQ MLVLAVDTATPAVTAGLVELEQAADGSATAARLCTIAARVRVDPRAHAEVLTPQILECLAEAGRSRTDLAAVVAGIGPGPFTGLRVGMATAAAFGDALGLPVHGACSLDAIAADVTTAADLPAGGELLVVTDARRREVYWARYRDGVRISGPGVIKPAELDTDGATSVAGSASHVDYFDLPVVPVETPSPAGLVRVAAADLLAGVAPEPLVPLYLRRPDAVENAYRSLDRTGA GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 35->220|Y378_MYCLE|3e-50|60.6|175/359| SEG 109->120|daiaadvttaad| BL:PDB:NREP 1 BL:PDB:REP 1->215|2gelA|4e-13|33.7|199/218| RP:PDB:NREP 1 RP:PDB:REP 3->217|2a6aA|8e-19|30.1|183/191| RP:PFM:NREP 1 RP:PFM:REP 45->104|PF00814|4e-10|53.3|60/260|Peptidase_M22| HM:PFM:NREP 1 HM:PFM:REP 45->161|PF00814|8.4e-27|38.9|113/268|Peptidase_M22| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00814|IPR000905| GO:PFM GO:0006508|"GO:proteolysis"|PF00814|IPR000905| RP:SCP:NREP 2 RP:SCP:REP 3->108|1okjA1|2e-15|35.5|93/106|c.55.1.9| RP:SCP:REP 124->214|1okjA2|2e-08|27.5|91/110|c.55.1.9| HM:SCP:REP 1->117|2a6aA1|3.7e-21|43.7|103/0|c.55.1.9|1/1|Actin-like ATPase domain| HM:SCP:REP 124->214|1okjA2|1.3e-18|35.2|91/110|c.55.1.9|1/1|Actin-like ATPase domain| OP:NHOMO 279 OP:NHOMOORG 279 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111111111111111111111--111111111111---1--1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--------------1--------------------------------------1--111-----1-------------1----------------1--11111--1----------111--1-111111-111-11-111111111111-11-11--------------1-1--111---1----------------1------------------------------------------1---1111111---------------11----111--------------------1----------111---1-------------------------------------------------------1111--1--1--11111111-1111-1-11--1-11---------11-1---1111111111-1111111111111111111111-1111-111111111111111-11111111-1--------------1-----1111---11111---------------------1-1111111111111-1111----------11111111111111---111----1111------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 91.4 SQ:SECSTR cEEEEEEcccccEEEEEEETTE##TTEEEEEEEcEEEEEEEcccGGGGGHHHHHHHHHHHHHTccGGGccEEEEEcccccHHHHHHHHHHHHHHHGGGTccEEEEcHHHHHHTcHHHHH##cccEEEEEEEEccTTEEEEEEEEEcEEEEEEEEEEHHHHHHHHHHEcTHHHHcTHHHcccEEEEccccccHHHHHHHHHHHTTccGGGTTHHHHcc################ DISOP:02AL 231-233| PSIPRED cEEEEEEccccHHEEEEEEccccccHHEEEEEccEEEEEEEEcHHHHHHHHHHHHHHHHHHHcccHHHccEEEEEcccccHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEEccccccccHHHccHHHHcccccEEEEcccHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccEEccccHHHHHHHHHcccccc //