[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55733.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->48 PF03752 * ALF 6.8e-05 34.6 26/43  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55733.1 GT:GENE BAD55733.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(990601..990852) GB:FROM 990601 GB:TO 990852 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55733.1 LENGTH 83 SQ:AASEQ MTDSRIDLAHAVALGSIDDEDQDEVQQLLDSADPEVRAAFHTEVQQSADALTALAELTATAPPPALRARLLAAIAAEQPPVAS GT:EXON 1|1-83:0| SEG 18->30|ddedqdevqqlld| SEG 50->77|altalaeltatapppalrarllaaiaae| HM:PFM:NREP 1 HM:PFM:REP 23->48|PF03752|6.8e-05|34.6|26/43|ALF| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 81-83| PSIPRED ccccHHHHHHHHHHcccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccc //