[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55738.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:363 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   172->204 PF10938 * YfdX 4.8e-05 33.3 33/155  
:BLT:SWISS 143->227 Y3447_MYCBO 3e-06 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55738.1 GT:GENE BAD55738.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 994240..995331 GB:FROM 994240 GB:TO 995331 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55738.1 LENGTH 363 SQ:AASEQ MKCMARDGERGRGDWKARRGSRNSGPYAGGAGDTGPVDIAAVRRDDALIDAIASDGPVQTDSAEEFQLAALLADWRAELIAAPLPSAPDLDTVVAAVNQEIGARKVRVGAQARGKLRLLYPITGAAAALALIIGGTTAFSYGAEPGDPLWRVKEVVFSEQAQTTVVQRADTELDQAKQALAQGNTTQAVALLERAQGNVDQISDGAKKQDLQNEWQRLLAQLRSISPELATQLEQTVQPSQPQRPEPGPTGTVLPTRPAPGDGNTVTMLPGGTTEPTQPAQPTQPTEPVEPTTEEPPVTPTQPQPTTEPPATGGPTQIPPTVVPTGNTGSPGVPDTGAPTMGPGGIQIPPGLLPPGVLPAPSS GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 143->227|Y3447_MYCBO|3e-06|30.6|85/299| SEG 122->138|itgaaaalaliiggtta| SEG 270->317|pggtteptqpaqptqptepveptteeppvtptqpqptteppatggptq| SEG 342->361|gpggiqippgllppgvlpap| HM:PFM:NREP 1 HM:PFM:REP 172->204|PF10938|4.8e-05|33.3|33/155|YfdX| OP:NHOMO 11 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------1----------1-------1111122----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-27, 111-113, 148-363| PSIPRED ccccccccccccccHHHHccccccccccccccccccHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //