[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55739.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   14->61 PF07201 * HrpJ 2e-04 41.7 %
:BLT:SWISS 1->126 Y386_MYCLE 3e-56 74.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55739.1 GT:GENE BAD55739.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(995492..995905) GB:FROM 995492 GB:TO 995905 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55739.1 LENGTH 137 SQ:AASEQ MRDHLPPGLPPDPFAGDPSDPSAALDAIEPGEPLDPHERLAVEEDLADLAVYEALLAHRGIRGLVVSCEDCRQDHYHDWDMLRANLLQLLVDGTVRPHEPAYDPTPEAYVTWDYCRGYADASMNEAFHGDGFDGFDS GT:EXON 1|1-137:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|Y386_MYCLE|3e-56|74.6|126/137| RP:PFM:NREP 1 RP:PFM:REP 14->61|PF07201|2e-04|41.7|48/163|HrpJ| GO:PFM:NREP 3 GO:PFM GO:0009405|"GO:pathogenesis"|PF07201|IPR010812| GO:PFM GO:0019867|"GO:outer membrane"|PF07201|IPR010812| GO:PFM GO:0046903|"GO:secretion"|PF07201|IPR010812| OP:NHOMO 43 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111112-111----------------11--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 135-137| PSIPRED ccccccccccccccccccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHHHHHHHcccccccccccccccccEEcHHHHHHHHHHHHHHHHcccccccccc //