[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55744.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->67 PF11804 * DUF3325 4.9e-05 32.7 52/106  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55744.1 GT:GENE BAD55744.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1001026..1001235) GB:FROM 1001026 GB:TO 1001235 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55744.1 LENGTH 69 SQ:AASEQ MAERKETERVGNGGPSASLLIMGLLALAVSVWGFVGPAATAGGAVSLGWILVIGAIVVGLLLVISPRRR GT:EXON 1|1-69:0| TM:NTM 2 TM:REGION 14->36| TM:REGION 43->64| SEG 47->64|lgwilvigaivvglllvi| HM:PFM:NREP 1 HM:PFM:REP 16->67|PF11804|4.9e-05|32.7|52/106|DUF3325| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13, 68-69| PSIPRED ccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccc //