[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55746.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PFM   40->212 PF09203 * MspA 4e-10 33.5 %
:HMM:PFM   38->212 PF09203 * MspA 3.7e-47 39.1 169/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55746.1 GT:GENE BAD55746.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1002992..1003630) GB:FROM 1002992 GB:TO 1003630 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55746.1 LENGTH 212 SQ:AASEQ MRRNIGLLAAALVSAGLLAAPAADAATLAPHEKTYTAPGGVEFTVGHRDHAVRPAPSLNGMPTNRDLYVDNTFYGRINAGTGTLSAGYLVACAVDLTAELNLGAEIGVDADLRAGVSIGPESVLPGLDVDMGPYLGAGIGVDLSLSPGTVVDLPVGEHPLHPGDEGYLFSRDRRIHVEGCGGPLTVQPYVFLTVDAAEVRADGAVFGDPFTL GT:EXON 1|1-212:0| SEG 7->29|llaaalvsagllaapaadaatla| RP:PFM:NREP 1 RP:PFM:REP 40->212|PF09203|4e-10|33.5|167/175|MspA| HM:PFM:NREP 1 HM:PFM:REP 38->212|PF09203|3.7e-47|39.1|169/175|MspA| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------1----------1---2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 21.7 SQ:SECSTR ################################################################################ccHHHHHHHHHHHHHHHHHH###HTTTcccEEEEc###cHHHHHHHHHHHHT################################################################################ DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHHHHHHHHcccccccHHcccccEEEEccccEEEEEEEcccEEEEcccccccccccEEEEEEEEEEEEEccccEEEEEEEEEcccccccccccccEEccccccccccEEccccccccccccccccccccEEEEcccccccccccccccccccccccccEEEcccEEEEEEcccHHHEEEEEEEEEEccccEEEEEEEcccccc //