[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55750.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:253 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 105->191 Y3395_MYCTU 7e-12 67.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55750.1 GT:GENE BAD55750.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1007421..1008182 GB:FROM 1007421 GB:TO 1008182 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55750.1 LENGTH 253 SQ:AASEQ MVVMGSDARVGETERQQKLAELRRRMAAIPGRGESAAARSPVAPRLRREPLPVPPALAGLLPDGGLGKGTVVSYAGARSLLAGLLAAVTEPGGHAAVVGVPGFGLLAAAEMGADLGRLAVIPDPGPDPVEVAAVLLDGLDLVVLGLRGAAVPPARARVIAARARNKGATLVVTDGRWPDATLRMDARIAGYTGLGAGYGRLRSFCLDVTAAHRAGPPRRGRIELRPHGGRVAWFDVDTGHTVSDLPVAGEAAS GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 105->191|Y3395_MYCTU|7e-12|67.8|87/100| SEG 41->69|pvaprlrreplpvppalagllpdgglgkg| SEG 75->87|agarsllagllaa| SEG 91->104|pgghaavvgvpgfg| SEG 129->164|vevaavlldgldlvvlglrgaavppararviaarar| SEG 210->221|aahragpprrgr| OP:NHOMO 23 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ---------------1111-11--1111111111111121----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-45, 251-253| PSIPRED cEEEccccccccHHHHHHHHHHHHHHHHccccccHHHHcccccHHHHcccccccHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHccEEEEEEEEEcccccHHHHHHHHHHHccEEEEccccccccccHHHHHHHHHHHcccEEEEEccccccccEEEEEEEEcEEEcccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEEEcccccEEccccccccccc //