[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55754.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:244 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55754.1 GT:GENE BAD55754.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1011375..1012109) GB:FROM 1011375 GB:TO 1012109 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55754.1 LENGTH 244 SQ:AASEQ MRGHRENRMRRGAGLSRHDDGMRHVRGTRRGRMRRRGRGIGCSLMPVRDSGMRRDRGGRPGDTVPLPRRRGSVRRNRMRRTGPPMRRSTRRRHRSSGVCGGMRRISLRRCGIHRSAARRRGDGTGRVPRSWHRRGWRCGGVHRRTPTGASVRRCRTLPPRRRHAFPPCSLRPCPFAPAPIEQSRRRHGDQLPNEALGAAPSDTRPYRSGHIAHEGTASTGPDQADITAVGAARPPPRRCRRRRR GT:EXON 1|1-244:0| SEG 21->41|gmrhvrgtrrgrmrrrgrgig| SEG 48->62|rdsgmrrdrggrpgd| SEG 68->97|rrrgsvrrnrmrrtgppmrrstrrrhrssg| SEG 152->162|rrcrtlpprrr| SEG 233->243|rppprrcrrrr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 29-32, 49-62, 70-97, 116-125, 180-195, 236-244| PSIPRED ccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHcccccccccHHHHHcccccccccccccccHHHHHHHccccHHHcccccccccccccccccHHHHHHHHcccccHHHHcccccccccccccccccccccccccccccEEEEccccccHHHHHHccc //