[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55757.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   70->266 2p1gB PDBj 4e-16 31.3 %
:RPS:SCOP  54->266 2im9A1  d.3.1.13 * 1e-64 29.0 %
:HMM:SCOP  29->268 2im9A1 d.3.1.13 * 1.6e-79 47.5 %
:RPS:PFM   62->263 PF07313 * DUF1460 3e-51 49.0 %
:HMM:PFM   63->260 PF07313 * DUF1460 2.3e-72 46.5 198/216  
:BLT:SWISS 19->65 SIK1_RAT 3e-04 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55757.1 GT:GENE BAD55757.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1013979..1014785) GB:FROM 1013979 GB:TO 1014785 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55757.1 LENGTH 268 SQ:AASEQ MRFLARALAVVIALVCGVVPLLPTAVAAPGVAVDEVTARRIDELLAVRAASAGLPTGELLEALSRPLLGTPYGANMLIGSAGEPEQLVVDLRRVDCFTFLDYVAALSRSGDRDDFVRHLIETRYAGGQVDFAHRKHFFTDWAHVDRIAATDITASLSPATVTVTKHLNAKADGSAYLPGLPVVDRTLGFIPASAVDAAVLAGLRTGDFLGAYADAPGLDVTHVGLVVQTPDGPVFRNASSVPGVDRVVDTPLTDYLRTVPGIVVLRPN GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 19->65|SIK1_RAT|3e-04|38.3|47/100| TM:NTM 1 TM:REGION 9->31| SEG 4->15|laralavvialv| BL:PDB:NREP 1 BL:PDB:REP 70->266|2p1gB|4e-16|31.3|195/230| RP:PFM:NREP 1 RP:PFM:REP 62->263|PF07313|3e-51|49.0|202/211|DUF1460| HM:PFM:NREP 1 HM:PFM:REP 63->260|PF07313|2.3e-72|46.5|198/216|DUF1460| RP:SCP:NREP 1 RP:SCP:REP 54->266|2im9A1|1e-64|29.0|210/299|d.3.1.13| HM:SCP:REP 29->268|2im9A1|1.6e-79|47.5|238/0|d.3.1.13|1/1|Cysteine proteinases| OP:NHOMO 65 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- --------------1------1----------11111---------------------------------------------------1--1------------1--11-------------------------------------1---111---------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11-1------------------------------------------------------------------------------------------------------------------------2----1------------------------------------------------------------------------------------------1----------------------------1------------------------------------------1-----1--------------------------------1--11-11111111-1-111111-------1--11111111111--------------------------------------------------1--------1----------------11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 73.5 SQ:SECSTR #####################################################################ccccccGGTTGccccccccccTTcccHHHHHHHHHHHHccGGGTHHHHHHHHHHcGGGcccGGGccccHHHHHHHHTTccEEHHHHHcccEEEccTTTTTcHHHHHHHHHHHHTTcEEEcEEGGGccTTccTTccTTcEEEEEEccTTccEEEEEEEEEETTEEEEEEEETTTTEEEEccccHHHHHTTEEEEEEEE## DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccEEEEEEccccHHHHHHHHHHHHHccccHHHHHHHHHHcEEcccEEEEccccccEEccccccccHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccccHHHHcccccccEEEEEEccccccEEEEEEEEEEcccEEEEEEcccccccEEEEcHHHHHHHHcccEEEEEcc //