[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55759.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->145 2g40A PDBj 4e-04 30.7 %
:HMM:PFM   90->109 PF07721 * TPR_4 8.3e-05 40.0 20/26  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55759.1 GT:GENE BAD55759.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1016092..1016553 GB:FROM 1016092 GB:TO 1016553 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55759.1 LENGTH 153 SQ:AASEQ MRMADDRMADIFAAVRLGSDNPEAARKALGALWDELDPSAAPLQRCVVAHHLAVLQDDDQEALAWDQRALGAVFGPGVALDEGMRCFLPSLYLNLADSHRRVGDFDAARMQLAIARGHLRILAEDAYGELIRSGLDRVAAAIAAGSTERLRRE GT:EXON 1|1-153:0| BL:PDB:NREP 1 BL:PDB:REP 5->145|2g40A|4e-04|30.7|127/164| HM:PFM:NREP 1 HM:PFM:REP 90->109|PF07721|8.3e-05|40.0|20/26|TPR_4| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ------------------------------------21----------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 127 STR:RPRED 83.0 SQ:SECSTR ####HHHHHHTTcEEEcTTTHHHHHHHHHTTccEEEccTTccGGGccTT##cEEEcccccccHHHHHHccEEEEcccEEETTTTEEEEc####ccTTTccGGGGT########cccEEEEEEEGGGEEccHHHHHHHHHHHHHTT######## DISOP:02AL 1-4, 149-153| PSIPRED cccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHccc //