[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55762.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:345 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   157->238 PF04582 * Reo_sigmaC 5.4e-06 31.2 80/326  
:BLT:SWISS 54->251 Y4889_BURCM 4e-05 28.1 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55762.1 GT:GENE BAD55762.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1020943..1021980 GB:FROM 1020943 GB:TO 1021980 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55762.1 LENGTH 345 SQ:AASEQ MTASAPRRIPFRRRPGRYAATMRKLAVLCVALLGSVLLVSCGGDGEDSGARPDMGTAAPAISPPGLREQAPSPADNAPDTSTLDRKEVVTGSVEITAADPIAAAGRVADQVRAVDGRIDSRTEQPGTDDTDPSATLTVRVPTDRIDAFVDGLGGIGELTRVSTNRDDVTMQWEDLDARIKALQASVDRLRALIAGATTTADLIAAEEALGSRQGELDSLTAQQRRLADQVALSTLTISITAADKGSRDDGPTNFWDGVVAGWHSLVDWLQDAIVFLGKAVPWLGFLALLGALGWALLRLVRRRPAPAAGTRPTAAVGPDRRESAPQTGGSDADQGGARDDQTEQP GT:EXON 1|1-345:0| BL:SWS:NREP 1 BL:SWS:REP 54->251|Y4889_BURCM|4e-05|28.1|196/236| COIL:NAA 75 COIL:NSEG 1 COIL:REGION 157->231| TM:NTM 2 TM:REGION 25->41| TM:REGION 273->295| SEG 6->17|prripfrrrpgr| SEG 25->42|lavlcvallgsvllvscg| SEG 283->318|lgflallgalgwallrlvrrrpapaagtrptaavgp| HM:PFM:NREP 1 HM:PFM:REP 157->238|PF04582|5.4e-06|31.2|80/326|Reo_sigmaC| OP:NHOMO 49 OP:NHOMOORG 48 OP:PATTERN --------------------1----------------------11--1-1--------------1--- ----1---------1------1--1------11---1-11---111--------------1-1-1-11111------------------------------------------------------1--1-------111-1---1-1--1-----11----------11-----------------------------------------1---------------------1--------------------------------------------------------------------------------------------1-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 42-82, 119-133, 244-248, 314-345| PSIPRED ccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHcccccccccccccccccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHccEEEEccccccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccccccccccccc //