[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55763.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.206.1
:72 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->70 1n91A  d.206.1.1 * 4e-15 27.7 %
:HMM:SCOP  1->72 1n91A_ d.206.1.1 * 2.9e-12 40.8 %
:RPS:PFM   5->66 PF02594 * DUF167 4e-06 45.9 %
:HMM:PFM   4->71 PF02594 * DUF167 4.8e-22 44.1 68/78  
:BLT:SWISS 5->70 Y3845_MYCS2 2e-20 68.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55763.1 GT:GENE BAD55763.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1021949..1022167 GB:FROM 1021949 GB:TO 1022167 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55763.1 LENGTH 72 SQ:AASEQ MRATIKPNSRKGPLVETAADGTLTLYVRAPAVEGKANKAAIDLLAAHYGVPTSAVRLTAGATSRHKRFDIDE GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 5->70|Y3845_MYCS2|2e-20|68.2|66/75| RP:PFM:NREP 1 RP:PFM:REP 5->66|PF02594|4e-06|45.9|61/77|DUF167| HM:PFM:NREP 1 HM:PFM:REP 4->71|PF02594|4.8e-22|44.1|68/78|DUF167| RP:SCP:NREP 1 RP:SCP:REP 5->70|1n91A|4e-15|27.7|65/108|d.206.1.1| HM:SCP:REP 1->72|1n91A_|2.9e-12|40.8|71/108|d.206.1.1|1/1|YggU-like| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- --------------1------1--11-1-11-1---1-----------------------------------------------------------------------------------------------------------------11-------------1-111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 66-67| PSIPRED cEEEEcccccccEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEEcccccEEEEEEcc //