[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55764.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:53 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->37 PF04471 * Mrr_cat 3.4e-05 35.5 31/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55764.1 GT:GENE BAD55764.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1022198..1022359) GB:FROM 1022198 GB:TO 1022359 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55764.1 LENGTH 53 SQ:AASEQ MGAATGLDVAALVTTAAAFTPQARSDAERMAIRLVDSRAPAAWASATGPAPWQ GT:EXON 1|1-53:0| SEG 2->18|gaatgldvaalvttaaa| SEG 39->51|apaawasatgpap| HM:PFM:NREP 1 HM:PFM:REP 6->37|PF04471|3.4e-05|35.5|31/100|Mrr_cat| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 51-53| PSIPRED cccccccHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccccccc //