[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55766.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:104 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   65->98 PF11222 * DUF3017 4e-04 55.9 %
:HMM:PFM   23->98 PF11222 * DUF3017 9e-29 55.3 76/76  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55766.1 GT:GENE BAD55766.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1022932..1023246 GB:FROM 1022932 GB:TO 1023246 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55766.1 LENGTH 104 SQ:AASEQ MSDVEGSGEPRGGAGQFLRTHLPMVLVGLVVLVAVVFVASDRWRRGALIFGGAALLAAALRLCLPSIRVGVLAVRSKPFDVAALTLLGSAIVFLAVTINTLGVG GT:EXON 1|1-104:0| TM:NTM 3 TM:REGION 19->40| TM:REGION 48->70| TM:REGION 81->103| SEG 25->38|vlvglvvlvavvfv| SEG 44->64|rrgalifggaallaaalrlcl| RP:PFM:NREP 1 RP:PFM:REP 65->98|PF11222|4e-04|55.9|34/76|DUF3017| HM:PFM:NREP 1 HM:PFM:REP 23->98|PF11222|9e-29|55.3|76/76|DUF3017| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccc //