[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55771.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  500/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
f.38.1
:443 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  12->208 1pw4A  f.38.1.1 * 2e-09 15.1 %
:HMM:SCOP  23->411 1pw4A_ f.38.1.1 * 1.1e-61 29.0 %
:RPS:PFM   37->290 PF07690 * MFS_1 5e-15 30.7 %
:HMM:PFM   37->262 PF07690 * MFS_1 1.2e-30 24.4 225/353  
:HMM:PFM   255->415 PF07690 * MFS_1 4.7e-17 23.8 160/353  
:BLT:SWISS 34->345 YDHP_ECOLI 3e-56 38.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55771.1 GT:GENE BAD55771.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1028244..1029575 GB:FROM 1028244 GB:TO 1029575 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD55771.1 LENGTH 443 SQ:AASEQ MPVAGRLHGHVTSPATIAPVRSDSPRTEWHVPAMLALALGGFGIGTTEFVTMGLLPDIAVAMHVSEPTAGHAVSAYALGVVVGAPLLAALCARVPRKRLLVALMVAFTLGNLATVLAPTFHTLVVARFVAGLPHGAYFGVASLAAASLAPVGRRAKAVAAVMLGLSAANVVGVPAATWLGQHFGWRDAFVVVALIGAATVAALLRFVPELTGLVITNPLTELGALRRTQVLATLAVGAIGFGGMFAVYTYIATTLTDVAGMAAGAVPLVLALFGLGMVAGNVAGGVLADRGVDRSIFVAMVTMAVVLAAFAAAAHHPVTAAIGAFLVGASGAALAPGLQTRLMDVAADAQTLAAALNHAALNIANAAGAWLGGLVIAAGFGYTAPALVGAGLAVTGVLLFTVTVWARPPRRAGGAVTDRRIDTDTSTSDALTYSSVCNRRIAG GT:EXON 1|1-443:0| BL:SWS:NREP 1 BL:SWS:REP 34->345|YDHP_ECOLI|3e-56|38.8|312/389| TM:NTM 10 TM:REGION 31->53| TM:REGION 73->95| TM:REGION 104->126| TM:REGION 158->180| TM:REGION 191->213| TM:REGION 230->252| TM:REGION 262->284| TM:REGION 292->314| TM:REGION 318->340| TM:REGION 375->397| SEG 141->149|aslaaasla| SEG 297->321|fvamvtmavvlaafaaaahhpvtaa| SEG 346->374|aadaqtlaaalnhaalnianaagawlggl| SEG 417->429|tdrridtdtstsd| RP:PFM:NREP 1 RP:PFM:REP 37->290|PF07690|5e-15|30.7|254/347|MFS_1| HM:PFM:NREP 2 HM:PFM:REP 37->262|PF07690|1.2e-30|24.4|225/353|MFS_1| HM:PFM:REP 255->415|PF07690|4.7e-17|23.8|160/353|MFS_1| GO:PFM:NREP 1 GO:PFM GO:0055085|"GO:transmembrane transport"|PF07690|IPR011701| RP:SCP:NREP 1 RP:SCP:REP 12->208|1pw4A|2e-09|15.1|192/434|f.38.1.1| HM:SCP:REP 23->411|1pw4A_|1.1e-61|29.0|386/447|f.38.1.1|1/1|MFS general substrate transporter| OP:NHOMO 1448 OP:NHOMOORG 518 OP:PATTERN -------11111111-----------------------1-----1-----1-1--------------- 122--12233321321122-21--1522222111115864111-3256133134511511--1-237255-2111322--3---------21-1-------3-1131-12--------------------------111--1111---------------------------------------------11-8444443361464356215578544112331211111-D921123213111111242323113-11-11-1223311112--3221-----------------------------------------------------------1----------1------11------------------4----11-131532---2-11111111111114-2231111116--43322316334542-1--21-----112222222213331--2--------------------------------2-2532278EGBFC43333CC5A333544D967672-1554-2322311-4333--11131-1---------213-------111---12-21--1------3---11---12121-121111111-------111211-2-21121121224112--11211--1----------3413-934554444444-44444444445454444428B8561314244334333434343A43344441-322222222222---------1111--126111-1--11-1---133333241117156444769397872767--1111-1--1--1-----112--67443442222------11111--------------------------------------------------- -----------------1--------------------------------1---------------------------------------------1------2------------------------------------------------------------------A-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 7-27, 208-223, 406-420| PSIPRED ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccc //