[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55778.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.9.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   58->147 1brsE PDBj 7e-09 13.8 %
:HMM:SCOP  55->148 1ay7B_ c.9.1.1 * 2.4e-19 25.8 %
:HMM:PFM   60->148 PF01337 * Barstar 3.2e-13 24.1 87/90  
:HMM:PFM   10->54 PF11018 * Cuticle_3 0.00032 35.6 45/174  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55778.1 GT:GENE BAD55778.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1035845..1036342 GB:FROM 1035845 GB:TO 1036342 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55778.1 LENGTH 165 SQ:AASEQ MPVPLSRFLARPTEARPESATPEPIAAAAEPVFGALAVSAPELTEVRYRAPAGFAVRELRGTRMRTVAGVFDEWAAAFQFPYYFGQNKNAFDECLRDLDDFVGEAAGYVAVVRDAADLLAEQPAERDWFDEAMRDCADYWRRRDVSFRVVLQGEPDTTAVELELD GT:EXON 1|1-165:0| SEG 17->31|pesatpepiaaaaep| SEG 109->120|vavvrdaadlla| RP:PDB:NREP 1 RP:PDB:REP 58->147|1brsE|7e-09|13.8|80/86| HM:PFM:NREP 2 HM:PFM:REP 60->148|PF01337|3.2e-13|24.1|87/90|Barstar| HM:PFM:REP 10->54|PF11018|0.00032|35.6|45/174|Cuticle_3| HM:SCP:REP 55->148|1ay7B_|2.4e-19|25.8|89/89|c.9.1.1|1/1|Barstar-related| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 54.5 SQ:SECSTR #########################################################EEEGGGcccHHHHHHHHHHHHTccTTccccHHHHHHHHHHTccccEEEEEEEEEEEcHHHETHHHHHHHccHHHHHHHHHHTTccEEEEE################## DISOP:02AL 1-2, 14-29| PSIPRED ccccHHHHHccccccccccccccccccccccHHHHHHcccHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHccccHHHcccHHHHHHHHHcHHHcccccccEEEEHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEc //