[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55783.1
DDBJ      :             putative penicillin-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  580/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
e.3.1
:434 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   98->368 2bcfA PDBj 1e-47 46.6 %
:RPS:PDB   99->368 2bcfA PDBj 4e-30 45.1 %
:RPS:SCOP  103->357 1hd8A2  e.3.1.1 * 6e-54 29.9 %
:HMM:SCOP  98->359 1hd8A2 e.3.1.1 * 2.1e-58 38.2 %
:RPS:PFM   109->338 PF00768 * Peptidase_S11 1e-31 39.7 %
:HMM:PFM   107->339 PF00768 * Peptidase_S11 1.9e-39 32.9 222/241  
:HMM:PFM   404->424 PF12555 * TPPK_C 0.0008 52.4 21/53  
:BLT:SWISS 105->367 DACD_SALTY 1e-24 39.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55783.1 GT:GENE BAD55783.1 GT:PRODUCT putative penicillin-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1040348..1041652) GB:FROM 1040348 GB:TO 1041652 GB:DIRECTION - GB:PRODUCT putative penicillin-binding protein GB:PROTEIN_ID BAD55783.1 LENGTH 434 SQ:AASEQ MTARLSVPLRRLTAALTVAAALGAAVAIPAAAAPTAPTPPTTTAPFTTPETDTCPQKNVPPPAVDTSEVPAPGEPAPTPLPVPVPPIGGARMGECGVVVPDDAPPLPRDISATAWMVSDLDTGEVLAAKDPHGRYRPASTIKVLLAIVALRTLDLDRVVTGTQADADVDGTRVGIGPGGRYTNRQLMQALIMASGNDAAHAIAAQLGGDKATVARMNEVAKSLSAFDTRAATPSGLDGPGMTTSAYDLSLLFREAMTIPLFAELIRTEQIDFPGYPKNPLIPDDTDHPGFPIGNDNQLLYNYAGALGGKTGFTDDARQTFVAAAERDGRRLVVTLLKADVLPIRPWEQAARLLDYGFALPAGASVGSLPGAATDATDTEPNVVLAAPPPDDDETATAAQPERRHAGARTLLIVGGLVAIAVLLLGARRVSRPRR GT:EXON 1|1-434:0| BL:SWS:NREP 1 BL:SWS:REP 105->367|DACD_SALTY|1e-24|39.5|248/390| TM:NTM 2 TM:REGION 14->35| TM:REGION 406->426| SEG 13->53|taaltvaaalgaavaipaaaaptaptpptttapfttpetdt| SEG 69->90|vpapgepaptplpvpvppigga| SEG 410->426|llivgglvaiavlllga| BL:PDB:NREP 1 BL:PDB:REP 98->368|2bcfA|1e-47|46.6|253/255| RP:PDB:NREP 1 RP:PDB:REP 99->368|2bcfA|4e-30|45.1|253/255| RP:PFM:NREP 1 RP:PFM:REP 109->338|PF00768|1e-31|39.7|219/235|Peptidase_S11| HM:PFM:NREP 2 HM:PFM:REP 107->339|PF00768|1.9e-39|32.9|222/241|Peptidase_S11| HM:PFM:REP 404->424|PF12555|0.0008|52.4|21/53|TPPK_C| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF00768|IPR001967| GO:PFM GO:0009002|"GO:serine-type D-Ala-D-Ala carboxypeptidase activity"|PF00768|IPR001967| RP:SCP:NREP 1 RP:SCP:REP 103->357|1hd8A2|6e-54|29.9|231/243|e.3.1.1| HM:SCP:REP 98->359|1hd8A2|2.1e-58|38.2|246/0|e.3.1.1|1/1|beta-lactamase/transpeptidase-like| OP:NHOMO 1302 OP:NHOMOORG 583 OP:PATTERN -------------------------------------------------------------------- 1---3111111-1-22222-231123222222333311111111----------------22--111443--------11-11-1--------------------------111111-11----1111-11111-1---------3---------------------------------------------433555557766766776343322677333342211112144--------------------------------------1---------------------------------------------------333444444444434434444444451-5132355554234333333--2-1-111122222232332111333244444343443-3323323343113334443444333321111212111222222222222221222------------11111111111111111111211221231111111333311214444231121111--1112222222132211231222222222221112221-----1-22-111-1-1---1--------121--------------------1---22332111111112222222122221211211--11111------33223344444434443-4454444444444444443343222223332333333323223423432232-333333333333--1-111111111211211111-11111-11-13333333111112222111111111222211111111111113333333322212111111111111111-------1111111---------------------------------------211 --------------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 70.0 SQ:SECSTR ################################################################################################HHcccTTccccccccccEEEEEETTTcEEEEEEcTTcccccGGGHHHHHHHHHHHHccTTcEEEccTGGGccccccccccTTcEEEHHHHHHHHHHcccHHHHHHHHHTTcHHHHHHHHHHHHHHHHTcTTcccccccccccTTccccHHHHHHHHHHHHcHHHHHHHHccEEEccHHTccccHHHHHHHHccEEEEcccTHHHHcTTEEEEEEEEETTTEEEEEEEEEETTEEEEEEEEcccTTcccHHHHHHHHHHHHHHccTTcccEEcTTTEEEEEEGGGTEEEEccccccHHHHHHHHH################################## DISOP:02AL 1-4, 27-79, 367-388, 391-408, 431-434| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccHHHcccccccccHHcccccccccEEEEEEEccccEEEEEccccccccHHHHHHHHHHHHHHHHcccccEEEEcHHHHcccccEEEEEcccEEcHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcEEEEccccccccEEEcccccccccccccccccccccccccEEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccc //