[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55786.1
DDBJ      :             putative phenylalanine hydroxylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  149/915 : Eukaryota  86/199 : Viruses  0/175   --->[See Alignment]
d.178.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   23->280 1phzA PDBj 1e-45 38.1 %
:RPS:PDB   22->282 3e2tA PDBj 6e-22 34.2 %
:RPS:SCOP  25->282 1ltuA  d.178.1.1 * 3e-66 22.2 %
:HMM:SCOP  4->289 1tohA_ d.178.1.1 * 6e-92 37.9 %
:RPS:PFM   56->278 PF00351 * Biopterin_H 2e-37 38.3 %
:HMM:PFM   22->282 PF00351 * Biopterin_H 9.9e-72 42.7 260/332  
:BLT:SWISS 23->267 PH4H_DROME 3e-47 39.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55786.1 GT:GENE BAD55786.1 GT:PRODUCT putative phenylalanine hydroxylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1043906..1044805) GB:FROM 1043906 GB:TO 1044805 GB:DIRECTION - GB:PRODUCT putative phenylalanine hydroxylase GB:PROTEIN_ID BAD55786.1 LENGTH 299 SQ:AASEQ MFTEAQLYSPVTRDRDGAVTVHLSDEHPGVRDPDYRARRNAIAALALGYTPGAALPRVDYTEEEQRVWRMVSTELARKHRTYASAEVLAAAERLALPTDHIPQLDEVSAALAPLSGFRYVPAAGLVPLREFFGSFAESVFHSTQYIRHHSAPLYTPEPDAIHEIIGHANQIASPRFAAIYRTVGAAVARLRTEAALKFLADVFWFSMEFGVVRERGEIRCYGAGLLSSFGEIEEFRRARLRPLDVVAMGTEPYDITHYQPVLYCAESIGQIEDVIGGFFAEMDDETPLRARRVGSGSRG GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 23->267|PH4H_DROME|3e-47|39.8|244/452| SEG 36->47|rarrnaiaalal| SEG 83->96|asaevlaaaerlal| BL:PDB:NREP 1 BL:PDB:REP 23->280|1phzA|1e-45|38.1|257/403| RP:PDB:NREP 1 RP:PDB:REP 22->282|3e2tA|6e-22|34.2|260/307| RP:PFM:NREP 1 RP:PFM:REP 56->278|PF00351|2e-37|38.3|222/239|Biopterin_H| HM:PFM:NREP 1 HM:PFM:REP 22->282|PF00351|9.9e-72|42.7|260/332|Biopterin_H| GO:PFM:NREP 2 GO:PFM GO:0016714|"GO:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen"|PF00351|IPR019774| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00351|IPR019774| RP:SCP:NREP 1 RP:SCP:REP 25->282|1ltuA|3e-66|22.2|257/284|d.178.1.1| HM:SCP:REP 4->289|1tohA_|6e-92|37.9|285/336|d.178.1.1|1/1|Aromatic aminoacid monoxygenases, catalytic and oligomerization domains| OP:NHOMO 483 OP:NHOMOORG 235 OP:PATTERN -------------------------------------------------------------------- 111---------------------------------1------1-1------------------------------------------------------------111---------------------------111-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------1--1---11-111----111------------------------1---------------11--------------11-2------11111111111111-1111111111111--11111111112-11-------1---------------------------------------1---1-----------------------------11-1--1111-1111111111111111111---------------------------------------------------------------------------------------------------2-----1111--1-------------------------111-11111111111111111-------------111111111111111111111--------------------------------------------------------------- ----111-21--111----------------------------------------------------------------------------------------112-1-366A57A6433235464353AM6-554333353445333334234366565553344356-F3511111-----111------1-311-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 90.0 SQ:SECSTR ##################cccTcccccHHHHcHHHHHHHHHHHHHHHHccTTcccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHTHHHHHHHHTccccHHHHHHHHHHHHccEEEEcccEEcHHHHHHHHHTTEEEEccccccTTcTTccccccHHHHHHHTHHHHTcHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHTTTTTcEEEETTEEEEccHHHHTcHHHHHHcccccEEEccHHHHTTcccccccccccEEEEccHHHHHHHHHHHHTTcTTccc############ DISOP:02AL 1-5, 295-299| PSIPRED ccccHHHHcccccccccEEEEEEcccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHccccEEEcccccccHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHccHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHEEEEEEEEEccccEEEEcccccccHHHHHHHcccccccccHHHHHcccccccccccHHEEcccHHHHHHHHHHHHHHccccccHHHHHHcccccc //