[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55787.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   69->89 PF00737 * PsbH 0.0002 47.6 21/52  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55787.1 GT:GENE BAD55787.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1044920..1045471) GB:FROM 1044920 GB:TO 1045471 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55787.1 LENGTH 183 SQ:AASEQ MQGHHSGHADHPAHDHTTHVDHTTHVDHAAHKDHAAHTDHSTWQMAMTATLHCLTGCAIGEVLGMVIGTALGWGNVPTMVLAIVLAFVFGYSLTMRGVMRAGVAFGAALSVALAADTVSITVMEIVDNGVLLLVPGAMHAGITDALFWGSLALAFAVAFVVTTPVNKWLIGRGKGHAVVHAYH GT:EXON 1|1-183:0| TM:NTM 4 TM:REGION 45->67| TM:REGION 74->96| TM:REGION 100->122| TM:REGION 136->158| SEG 8->42|hadhpahdhtthvdhtthvdhaahkdhaahtdhst| SEG 101->115|agvafgaalsvalaa| SEG 151->161|lalafavafvv| HM:PFM:NREP 1 HM:PFM:REP 69->89|PF00737|0.0002|47.6|21/52|PsbH| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ---------------------------------1111-------1----------1---------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-29, 182-183| PSIPRED ccccccccccccccccccccccccccccccccccccccccHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccc //