[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55789.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:179 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  4->101 1v96A1  c.120.1.1 * 2e-04 10.2 %
:HMM:PFM   129->162 PF11848 * DUF3368 0.00021 34.4 32/48  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55789.1 GT:GENE BAD55789.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1046284..1046823) GB:FROM 1046284 GB:TO 1046823 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55789.1 LENGTH 179 SQ:AASEQ MSASRTLVFDTSPLCHFARSDWLGVLKAVVGERAAVIPDVVAFELRNLASNDDRIGAVLRAPWIEHRELRNPQELAAFAQFSARLVRRNRNRGEAGVLALARTLPGIAVVDDAAGRRAARDYSIEYCPTLRLLCEAIRTGLLTVPLVSALADDLLINEYRLPFAPGGFEKWAREHGMLE GT:EXON 1|1-179:0| SEG 108->121|avvddaagrraard| HM:PFM:NREP 1 HM:PFM:REP 129->162|PF11848|0.00021|34.4|32/48|DUF3368| RP:SCP:NREP 1 RP:SCP:REP 4->101|1v96A1|2e-04|10.2|98/146|c.120.1.1| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 178-179| PSIPRED cccccEEEEcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHccccEEEHHcccHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEcHHHHHHHHHcccEEccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccc //