[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55799.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:414 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55799.1 GT:GENE BAD55799.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1055292..1056536) GB:FROM 1055292 GB:TO 1056536 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55799.1 LENGTH 414 SQ:AASEQ MASGDIVPIELGLTDGDLVTLWAPRWRDGDDEWMAFLGHEDTLYGFEGVAELAAFVRTNSDNDLVDHPAWKVVVGLSAAELEPEENYSYDLVGVPELAAGDPDPETIAELEETLEMVRNIGDVCELETVTKFFSSHPVLGALPSGVSAFVGRDGEELWDQIGAAIAKDWDAVLDAVDTVVSIPEVDADALAVAEAELLAAEENVVDADDVADAEEEEEFEPVDLDADDEDEEESFWHEVGIDPVKIVTSEGTYFTLRCYLDDEPIFLGRDGSILVFGSERALARYLADDHDHDLARVSTYGDVQTAAVDGSLEVEVTDENVYVLPGLAEDLAEGPRAVDIDQLDLAVELFTDAADYADDDAVETALAKSTPLGWYVSYLLNPDPTRLAPNPPYAAEAQAWRELERNFEARLVSE GT:EXON 1|1-414:0| SEG 184->233|evdadalavaeaellaaeenvvdaddvadaeeeeefepvdldaddedeee| SEG 352->361|daadyaddda| OP:NHOMO 39 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-31111111111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 412-414| PSIPRED cccccEEEEEEEEccccEEEEEccccccccHHHHHHHccccEEEEEccHHHHHHHHHccccccccccccHHHHHccccccccccccccccEEEEHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHcccEEEEEEcccEEEEEEEEEccEEEEEEcccEEEEEEcHHHHHHHHHHHccccHHHHccccHHHcccccccEEEEEEcccEEEcccHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHccc //