Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55800.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:HMM:PFM   19->93 PF02575 * DUF149 5.8e-09 21.3 75/93  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55800.1 GT:GENE BAD55800.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1056563..1056910) GB:FROM 1056563 GB:TO 1056910 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55800.1 LENGTH 115 SQ:AASEQ MSAEMDALVAGATAKLEALEAALYGLKQVKGTFTTEDGAVSVEVNSDGALVGLRLSEAVTAMAPADVGQLIVWACRQAAEDAGAQRSKVVATLNESFASDTTSVPGSPGGRPDSA GT:EXON 1|1-115:0| SEG 10->27|agataklealeaalyglk| HM:PFM:NREP 1 HM:PFM:REP 19->93|PF02575|5.8e-09|21.3|75/93|DUF149| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 103-115| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //