[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55801.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55801.1 GT:GENE BAD55801.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1056948..1057289) GB:FROM 1056948 GB:TO 1057289 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55801.1 LENGTH 113 SQ:AASEQ MSEQQIPNVTVAVSQNRSGTIAVKATDQGMPVEIKFERSEYRYGAQALANEILRLTQRSAVAARAKRREVLAESGMPADILDRLGLPTRQQAVDELDRIDDADTGPTSWMRPV GT:EXON 1|1-113:0| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccEEEEEEccccccEEEEEEccccccEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHcccccccccccc //