[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55803.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->115 PF10824 * DUF2580 8.8e-07 27.6 98/100  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55803.1 GT:GENE BAD55803.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1058415..1058777) GB:FROM 1058415 GB:TO 1058777 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55803.1 LENGTH 120 SQ:AASEQ MDDVLCLGTTDGGSTMSKMSADTEGIAAYGATAGVMAGEMAGVAAGAAAAAPALLGPIMGLIGGDFVAAYSAAHAGHVASIAQLSAVLSSMGGAAAGAATVLTETDLTNAAALRGAELDG GT:EXON 1|1-120:0| TM:NTM 3 TM:REGION 26->48| TM:REGION 52->74| TM:REGION 80->102| SEG 30->57|gatagvmagemagvaagaaaaapallgp| SEG 67->80|vaaysaahaghvas| SEG 92->99|ggaaagaa| HM:PFM:NREP 1 HM:PFM:REP 17->115|PF10824|8.8e-07|27.6|98/100|DUF2580| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 117-120| PSIPRED cccEEEEEccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHccccccc //