[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55806.1
DDBJ      :             putative purine nucleoside phosphorylase
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  371/915 : Eukaryota  135/199 : Viruses  0/175   --->[See Alignment]
c.56.2
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->258 1i80B PDBj 2e-76 58.9 %
:RPS:PDB   22->259 3e9rC PDBj 1e-54 33.8 %
:RPS:SCOP  20->261 1cb0A  c.56.2.1 * 7e-42 24.3 %
:HMM:SCOP  4->259 1g2oA_ c.56.2.1 * 3.1e-74 45.7 %
:RPS:PFM   113->224 PF01048 * PNP_UDP_1 1e-04 37.5 %
:HMM:PFM   22->256 PF01048 * PNP_UDP_1 1.6e-40 33.6 220/234  
:BLT:SWISS 13->258 PUNA_MYCTU 6e-76 58.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55806.1 GT:GENE BAD55806.1 GT:PRODUCT putative purine nucleoside phosphorylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1061149..1061952) GB:FROM 1061149 GB:TO 1061952 GB:DIRECTION - GB:PRODUCT putative purine nucleoside phosphorylase GB:PROTEIN_ID BAD55806.1 LENGTH 267 SQ:AASEQ MLAAEAAEAIAERTGVPRHRAAVVLGSGWQAAAAEIGEPSASVPMPELPGFGTPSAQGHVPVLHSVPVGSEHVLVLMGRQHLYEGYSPAEVVHPVATAVAAGAETVVLTNAAGGIRAGLRVGEPVLIADHLNLTGRSPLAGATFVDLVDAWDPGLRALARELDPELTEGVYAGLTGPQYETPAEIRMLRTVGADLVGMSTVLEAIAARSLGARLLGISLVTNLAAGVTGEHLSHAEVLAEGNAAAPRLGKLLRGVLERLGSAPDGAA GT:EXON 1|1-267:0| BL:SWS:NREP 1 BL:SWS:REP 13->258|PUNA_MYCTU|6e-76|58.9|246/268| SEG 3->12|aaeaaeaiae| SEG 88->107|paevvhpvatavaagaetvv| BL:PDB:NREP 1 BL:PDB:REP 13->258|1i80B|2e-76|58.9|246/263| RP:PDB:NREP 1 RP:PDB:REP 22->259|3e9rC|1e-54|33.8|237/284| RP:PFM:NREP 1 RP:PFM:REP 113->224|PF01048|1e-04|37.5|112/229|PNP_UDP_1| HM:PFM:NREP 1 HM:PFM:REP 22->256|PF01048|1.6e-40|33.6|220/234|PNP_UDP_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01048|IPR000845| GO:PFM GO:0009116|"GO:nucleoside metabolic process"|PF01048|IPR000845| RP:SCP:NREP 1 RP:SCP:REP 20->261|1cb0A|7e-42|24.3|230/268|c.56.2.1| HM:SCP:REP 4->259|1g2oA_|3.1e-74|45.7|256/0|c.56.2.1|1/1|Purine and uridine phosphorylases| OP:NHOMO 628 OP:NHOMOORG 521 OP:PATTERN -----------------------------1--1-------------1---11111111111---1--- 111-1------1-112211-31111111111111111111-1111111111111111111--111111111-------111--1111111111111----1-1112--21---------------1111111112111111---11---1------------------------------------11111111111111111111111121111111111-11111111111--------------------1-------------------------111111111111111111111111111111111111111111111221-1111111111-1111221211--2-111221111111111112--2-2----------------------------------1111111121--111111111111-------11111------------------------------------------------------------------------------------1----------------------------------1-1--111---111111111--------1-1111-1-1-------------------------111---11------1111--1------1--1-------1------1----1-1--11111-----11111-11-1---1--1--------1-1-1111111111-11----------1-1111-1111----111111111--------------------------------1111--1-1----------------------------1-1111--------------1-------------------------------------------2222221222--- ------1----111-11111111-1--1111111-111-1111--1----------------111111-11111-1111111111111-1211111----1--111-1-13563361112111143-21171-2121111111311111-41391112111211211531221231-------------1--116233- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 94.4 SQ:SECSTR ############HHTcccccEEEEccTTcHHHHHTcEEEEEEEEGGGcTTccccEETTEEcEEEEEEETTEEEEEEEccccGGGTccHHHHHHHHHHHHHHTccEEEEEEEEEEccTTccTTcEEEEEEEEcHHHHcTTTcccccccTTcccHHHHHHHHHcGGGEEEEEEEEccccccccHHHHHHHHHTTccEEEcccHHHHHHHHHTTcEEEEEEEEEEEcccTccccccHHHHHHHHHHHHHHHHHHHHHHHHTccTccc### DISOP:02AL 1-2, 260-267| PSIPRED cHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHcccEEEEccccccccccccccccccEEEEEEEccEEEEEEEccccccccccHHHHccHHHHHHHHcccEEEEEEcccccccccccccEEEEHHHHcccccccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHcccEEEccccHHHHHHHHccccEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //