[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55809.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55809.1 GT:GENE BAD55809.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1064123..1064503) GB:FROM 1064123 GB:TO 1064503 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55809.1 LENGTH 126 SQ:AASEQ MEENGSPVNSWSGSASMSARRAMRGPSSGPMSHSRPVPPGIRRGVSPALVSQLATNSVVANSVRDSSGLAWMCLRHWIRSAPCAASHRSTAARPSNAGSGTGSPSGASATARTVTSGAGGRVGGAA GT:EXON 1|1-126:0| SEG 10->29|swsgsasmsarramrgpssg| SEG 97->111|agsgtgspsgasata| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-38, 87-108, 124-126| PSIPRED cccccccccccccccHHHHHHHHcccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHcccccccccccc //